PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.12385s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 383aa    MW: 43126.4 Da    PI: 6.1566
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.12385s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.3e-083263592154
                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cagra.12385s0010.1.p 326 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 359
                           569*****************************87 PP

2ELK26.81.2e-09280301122
                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                           ELKh+L+++++++++++++E++
  Cagra.12385s0010.1.p 280 ELKHELKQGFKEKIVDIREEIM 301
                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.9E-20115159IPR005540KNOX1
PfamPF037901.2E-17117158IPR005540KNOX1
SMARTSM012563.0E-26166221IPR005541KNOX2
PfamPF037911.4E-19170220IPR005541KNOX2
SMARTSM011886.2E-4280301IPR005539ELK domain
PROSITE profilePS512139.446280300IPR005539ELK domain
PfamPF037892.9E-6280301IPR005539ELK domain
PROSITE profilePS5007111.985300363IPR001356Homeobox domain
SuperFamilySSF466891.88E-15302367IPR009057Homeodomain-like
SMARTSM003895.6E-10302367IPR001356Homeobox domain
CDDcd000863.87E-11303359No hitNo description
Gene3DG3DSA:1.10.10.609.8E-25307365IPR009057Homeodomain-like
PfamPF059201.7E-17320359IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009727Biological Processdetection of ethylene stimulus
GO:0071369Biological Processcellular response to ethylene stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSFNSSHLLP PQEEDLPLRH FSDQPPPSQR HFPETPSLVT TSFLNLPSTL ATADSDLAPP  60
PRNGDNSAPD ANPRWLSFHT EIQNTGEVRS EVIDGVNADG ETVLGVVGGE DWRSASYKAA  120
ILRHPMYEQL LAAHVACLRV ATPVDQIPRI DAQLSQFHTV AEKYSTLGVV VDNKELDHFM  180
SHYVVLLCSF KEQLQHHVCV HAMEAITACW EIEQSLQSLT GVSPSESNGK TMSDDEDDNQ  240
VDSEVNMFDG SLDGSDCLMG FGPLVPTERE RSLMERVKKE LKHELKQGFK EKIVDIREEI  300
MRKRRAGKLP GDTTSVLKEW WRTHSKWPYP TEEDKAKLVQ ETGLQLKQIN NWFINQRKRN  360
WNSNTSTSST LSKNKRKRTG KS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1356377RKRNWNSNTSTSSTLSKNKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3066610.0AF306661.1 Arabidopsis thaliana homeodomain transcription factor KNAT5 (KNAT5) mRNA, complete cds.
GenBankBT0260330.0BT026033.1 Arabidopsis thaliana At4g32040 mRNA, complete cds.
GenBankD439620.0D43962.1 Arabidopsis thaliana mRNA for homeodomein containing protein 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283917.10.0hypothetical protein CARUB_v10005036mg
SwissprotP480020.0KNAT5_ARATH; Homeobox protein knotted-1-like 5
TrEMBLR0GWW70.0R0GWW7_9BRAS; Uncharacterized protein
STRINGAT4G32040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32040.10.0KNOTTED1-like homeobox gene 5